Overview

  • Product name

  • Description

    Rabbit polyclonal to SOFAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SOFAT aa 295-441.
    Sequence:

    VQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQF ERTQSVNLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSA VAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTPETPAEI


    Database link: Q86YJ6

  • Positive control

    • WB: HeLa and HepG2 whole cell lysates. IHC-P: Human ovarian cancer tissue.
  • General notes

    Previously labelled as THNSL2. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab235042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 54 kDa.
IHC-P 1/200 - 1/500.

Target

  • Relevance

    SOFAT acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates. It degrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate (by similarity). There are 4 isoforms produced by alternative splicing.
  • Database links

  • Alternative names

    • FLJ10916 antibody
    • OTTHUMP00000160830 antibody
    • OTTHUMP00000160831 antibody
    • Secreted osteoclastogenic factor of activated T cells antibody
    • SOFAT antibody
    • THNSL2 antibody
    • Threonine synthase like 2 (S. cerevisiae) antibody
    • Threonine synthase like 2 antibody
    • THS2 antibody
    • TSH2 antibody
    see all

Images

  • All lanes : Anti-SOFAT antibody (ab235042) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 54 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for SOFAT using ab235042 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up