Overview

  • Product name

    Anti-Solute carrier family 22 member 5 antibody
    See all Solute carrier family 22 member 5 primary antibodies
  • Description

    Rabbit polyclonal to Solute carrier family 22 member 5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Baboon
  • Immunogen

    Recombinant fragment corresponding to Human Solute carrier family 22 member 5 aa 1-180.
    Sequence:

    MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRC RVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPG RDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKAPLTISLFF VGVLLGSFISGQLSDRFGRKNVLFVTMGMQ


    Database link: O76082

  • Positive control

    • MCF7, OVCAR3, A549, DU145, SW480, Mouse intestine and Mouse kidney cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 63 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Sodium-ion dependent, high affinity carnitine transporter. Involved in the active cellular uptake of carnitine. Transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Also relative uptake activity ratio of carnitine to TEA is 11.3.
  • Tissue specificity

    Strongly expressed in kidney, skeletal muscle, heart and placenta. Highly expressed in intestinal cell types affected by Crohn disease, including epithelial cells. Expressed in CD68 macrophage and CD43 T-cells but not in CD20 B-cells.
  • Involvement in disease

    Defects in SLC22A5 are the cause of systemic primary carnitine deficiency (CDSP) [MIM:212140]. CDSP is an autosomal recessive disorder of fatty acid oxidation caused by defective carnitine transport. Present early in life with hypoketotic hypoglycemia and acute metabolic decompensation, or later in life with skeletal myopathy or cardiomyopathy.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDSP antibody
    • High-affinity sodium-dependent carnitine cotransporter antibody
    • OCTN2 antibody
    • OCTN2VT antibody
    • Organic cation/carnitine transporter 2 antibody
    • S22A5_HUMAN antibody
    • Slc22a5 antibody
    • Solute carrier family 22 (organic cation/carnitine transporter) member 5 antibody
    • Solute carrier family 22 member 5 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180757. Blue DAPI for nuclear staining.
  • All lanes : Anti-Solute carrier family 22 member 5 antibody (ab180757) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : OVCAR3 cell lysate
    Lane 3 : A549 cell lysate
    Lane 4 : DU145 cell lysate
    Lane 5 : SW480 cell lysate
    Lane 6 : Mouse intestine cell lysate
    Lane 7 : Mouse kidney cell lysate

    Predicted band size: 63 kDa

References

ab180757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up