Overview

  • Product name

    Anti-Somatostatin antibody [7G5]
    See all Somatostatin primary antibodies
  • Description

    Mouse monoclonal [7G5] to Somatostatin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Somatostatin aa 1-116. Expressed in E. coli
    Sequence:

    MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAK YFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRE RKAGCKNFFWKTFTSC


    Database link: P61278

  • Positive control

    • Recombinant Human Somatostatin protein; Human HepG2 cell lysate; Human lung cancer and pancreas tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab140665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 13 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Somatostatin inhibits the release of somatotropin.
  • Sequence similarities

    Belongs to the somatostatin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Growth hormone release inhibiting factor antibody
    • Growth hormone release-inhibiting factor antibody
    • Prepro somatostatin antibody
    • SMS_HUMAN antibody
    • SMST antibody
    • Somatostatin 14 antibody
    • Somatostatin 28 antibody
    • Somatostatin-14 antibody
    • SST antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling Somatostatin with ab140665 at a 1/200 dilution followed by DAB staining.
  • Flow cytometric analysis of HepG2 cells labelling Somatostatin with ab140665 at 1/200 dilution (green); negative control (red).
  • Anti-Somatostatin antibody [7G5] (ab140665) at 1/500 dilution + Somatostatin recombinant protein

    Predicted band size: 13 kDa



    Expected MW is 38.2 kDa.
  • Immunohistochemical analysis of paraffin-embedded Human lung cancer tissue labeling Somatostatin with ab140665 at a 1/200 dilution followed by DAB staining.

References

This product has been referenced in:

  • Al-Amily IM  et al. The functional impact of G protein-coupled receptor 142 (Gpr142) on pancreatic ß-cell in rodent. Pflugers Arch 471:633-645 (2019). Read more (PubMed: 30767071) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse pancreas)
Antigen retrieval step
Heat mediated
Permeabilization
No
Specification
Mouse pancreas
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 10 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up