Overview

  • Product name

    Anti-Sorbitol Dehydrogenase antibody
    See all Sorbitol Dehydrogenase primary antibodies
  • Description

    Rabbit polyclonal to Sorbitol Dehydrogenase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Sheep
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Sorbitol Dehydrogenase aa 4-344. Expressed in E.coli. N-terminal tags.
    Sequence:

    AKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQH GRIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDE FCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGAL IEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVSLLAAKAMGAAQVVVTD LSASRLSKAKEVGADFILQISNESPQEIAKKVEGLLGSKPEVTIECTGVE TSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYCNTW PMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLK


    Database link: Q58D31

  • Positive control

    • WB: Recombinant bovine Sorbitol Dehydrogenase protein. Cow liver and kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.
  • Tissue specificity

    Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
  • Sequence similarities

    Belongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localization

    Mitochondrion membrane. Cell projection > cilium > flagellum. Associated with mitochondria of the midpiece and near the plasma membrane in the principal piece of the flagellum. Also found in the epididymosome, secreted by the epididymal epithelium and that transfers proteins from the epididymal fluid to the sperm surface.
  • Information by UniProt
  • Alternative names

    • DHSO_HUMAN antibody
    • L iditol 2 dehydrogenase antibody
    • L-iditol 2-dehydrogenase antibody
    • OTTHUMP00000161939 antibody
    • SDH antibody
    • Sorbitol dehydrogenase 1 antibody
    • Sorbitol dehydrogenase antibody
    • SORD 1 antibody
    • SORD antibody
    • SORD1 antibody
    see all

Images

  • Anti-Sorbitol Dehydrogenase antibody (ab231198) at 2 µg/ml + Cow kidney lysate
  • Anti-Sorbitol Dehydrogenase antibody (ab231198) at 2 µg/ml + Cow liver lysate
  • Anti-Sorbitol Dehydrogenase antibody (ab231198) at 2 µg/ml + Recombinant bovine Sorbitol Dehydrogenase protein

References

ab231198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up