Overview

  • Product name

  • Description

    Rabbit polyclonal to SORBS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SORBS1 aa 271-407.
    Sequence:

    DSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQ QKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKST QDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNR


    Database link: Q9BX66

  • Positive control

    • WB: Human tonsil tissue lysate. IHC-P: Human heart muscle, lymph node, cerebral cortex, colon and testis tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 69,77,87,90,91,95,101,112,127,139,142,143 kDa.

Target

  • Function

    Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions.
  • Tissue specificity

    Detected in skeletal muscle (at protein level). Widely expressed with highest levels in heart and skeletal muscle.
  • Sequence similarities

    Contains 3 SH3 domains.
    Contains 1 SoHo domain.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Cell junction > adherens junction. Cell membrane. Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Colocalizes with actin stress fibers. Also detected at the plasma membrane and in neuronal intranuclear inclusions. Colocalized with PXN at focal adhesions during myogenic differentiation.
  • Information by UniProt
  • Database links

  • Alternative names

    • c-Cbl-associated protein antibody
    • CAP antibody
    • CBL Associated Protein antibody
    • Ponsin antibody
    • SH3 domain protein 5 antibody
    • SH3D5 antibody
    • SH3P12 antibody
    • Sorbin and SH3 Domain Containing 1 antibody
    • Sorbin and SH3 domain-containing protein 1 antibody
    • Sorbs1 antibody
    • SRBS1_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SORBS1 (green) using ab224129 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-SORBS1 antibody (ab224129) at 0.4 µg/ml

    Lane 1 : Caco-2 cells lysates transfected with control siRNA
    Lane 2 : Caco-2 cells lysates transfected with target specific siRNA probe #1
    Lane 3 : Caco-2 cells lysates transfected with target specific siRNA probe #2

    Predicted band size: 69,77,87,90,91,95,101,112,127,139,142,143 kDa

  • Paraffin-embedded human colon tissue stained for SORBS1 using ab224129 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for SORBS1 using ab224129 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for SORBS1 using ab224129 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for SORBS1 using ab224129 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart muscle tissue stained for SORBS1 using ab224129 at 1/200 dilution in immunohistochemical analysis.

  • Anti-SORBS1 antibody (ab224129) at 1/500 dilution + human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 69,77,87,90,91,95,101,112,127,139,142,143 kDa

References

ab224129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up