Anti-SorCS1 antibody (ab237618)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SorCS1 antibody -
Description
Rabbit polyclonal to SorCS1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SorCS1 aa 34-175.
Sequence:GGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPG DRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLR DGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQ
Database link: Q8WY21 -
Positive control
- IHC-P: Human breast cancer tissue. ICC/IF: MCF7 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab237618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Relevance
SorCS1 belongs to the family of VPS10 domain-containing receptors (the name is derived from the yeast vacuolar protein sorting protein-10, which is involved in sorting of carboxy-peptidase Y from the Golgi apparatus to the vacuole). SorCS1 immunoreactivity is widespread in a population of neurons throughout the brain. Two different types of cellular localization were observed. Most SorCS1 immunoreactive neurons exhibit a punctate cytoplasmic staining which extends into the dendrites, whilst occassionally SorCS1 neuronal immunoreactivity is associated with the plasma membrane. -
Cellular localization
Membrane; Single-pass type I membrane protein -
Database links
- Entrez Gene: 114815 Human
- Omim: 606283 Human
- SwissProt: Q8WY21 Human
-
Alternative names
- FLJ41758 antibody
- FLJ43475 antibody
- FLJ44957 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SorCS1 antibody (ab237618)Paraffin-embedded human breast cancer tissue stained for SorCS1 using ab237618 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-SorCS1 antibody (ab237618)MCF7 (human breast adenocarcinoma cell line) cells stained for SorCS1 (green) using ab237618 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.
References
ab237618 has not yet been referenced specifically in any publications.
