Anti-SorCS1 antibody (ab237618)
Key features and details
- Rabbit polyclonal to SorCS1
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SorCS1 antibody -
Description
Rabbit polyclonal to SorCS1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SorCS1 aa 34-175.
Sequence:GGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPG DRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLR DGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQ
Database link: Q8WY21 -
Positive control
- IHC-P: Human breast cancer tissue. ICC/IF: MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab237618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Relevance
SorCS1 belongs to the family of VPS10 domain-containing receptors (the name is derived from the yeast vacuolar protein sorting protein-10, which is involved in sorting of carboxy-peptidase Y from the Golgi apparatus to the vacuole). SorCS1 immunoreactivity is widespread in a population of neurons throughout the brain. Two different types of cellular localization were observed. Most SorCS1 immunoreactive neurons exhibit a punctate cytoplasmic staining which extends into the dendrites, whilst occassionally SorCS1 neuronal immunoreactivity is associated with the plasma membrane. -
Cellular localization
Membrane; Single-pass type I membrane protein -
Database links
- Entrez Gene: 114815 Human
- Omim: 606283 Human
- SwissProt: Q8WY21 Human
-
Alternative names
- FLJ41758 antibody
- FLJ43475 antibody
- FLJ44957 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SorCS1 antibody (ab237618)
Paraffin-embedded human breast cancer tissue stained for SorCS1 using ab237618 at 1/100 dilution in immunohistochemical analysis.
-
MCF7 (human breast adenocarcinoma cell line) cells stained for SorCS1 (green) using ab237618 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab237618 has not yet been referenced specifically in any publications.