Overview

  • Product name
    Anti-Sortilin/NT3 antibody [CL6526]
    See all Sortilin/NT3 primary antibodies
  • Description
    Mouse monoclonal [CL6526] to Sortilin/NT3
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Sortilin/NT3 aa 608-735.
    Sequence:

    LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDY VVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGRE EHLTTNGYRKIPGDKCQGGVNPVREVKD


    Database link: Q99523

  • Positive control
    • IHC-P: Human cerebral cortex, testis, fallopian tube tissues; Mouse cerebral cortex and hippocampus tissue. WB: SK-MEL-30 cell lysate. ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml.
ICC/IF Use a concentration of 2 - 10 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function
    Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
  • Tissue specificity
    Expressed at high levels in brain, spinal cord, heart, skeletal muscle, thyroid, placenta and testis. Expressed at lower levels in lymphoid organs, kidney, colon and liver.
  • Involvement in disease
    Note=A common polymorphism located in a non-coding region between CELSR2 and PSRC1 alters a CEBP transcription factor binding site and is responsible for changes in hepatic expression of SORT1. Altered SORT1 expression in liver affects low density lipoprotein cholesterol levels in plasma and is associated with susceptibility to myocardial infarction.
  • Sequence similarities
    Belongs to the VPS10-related sortilin family. SORT1 subfamily.
    Contains 9 BNR repeats.
  • Domain
    The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding.
    The extracellular domain may be shed following protease cleavage in some cell types.
  • Post-translational
    modifications
    The N-terminal propeptide is cleaved by furin and possibly other homologous proteases.
  • Cellular localization
    Membrane. Endoplasmic reticulum membrane. Endosome membrane. Golgi apparatus > Golgi stack membrane. Lysosome membrane. Nucleus membrane. Cell membrane. Lysosome membrane. Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. May also be found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes may be enhanced by insulin.
  • Information by UniProt
  • Database links
  • Alternative names
    • 100 kDa NT receptor antibody
    • Glycoprotein 95 antibody
    • Gp 95 antibody
    • Gp95 antibody
    • LDLCQ6 antibody
    • Neurotensin receptor 3 antibody
    • NT 3 antibody
    • NT3 antibody
    • NTR 3 antibody
    • NTR3 antibody
    • OTTHUMP00000013784 antibody
    • SORT 1 antibody
    • SORT_HUMAN antibody
    • SORT1 (gene name) antibody
    • Sort1 antibody
    • Sortilin 1 antibody
    • Sortilin antibody
    see all

Images

  • Paraformaldehyde-fixed, Triton X-100 permeabilized RH-30 cells stained for Sortilin/NT3 (Green) using ab243043 at 10 µg/ml in ICC/IF analysis. Microtubules are visulized in red, nucleus in blue.

  • Anti-Sortilin/NT3 antibody [CL6526] (ab243043) at 1 µg/ml + SK-MEL-30 cell lysate
  • Paraffin-embedded mouse hippocampus tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse cerebral cortex tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

  • Negative control:

    Paraffin-embedded human lymph node tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human fallopian tube tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for Sortilin/NT3 using ab243043 at 1/5000 dilution in immunohistochemical analysis.

References

ab243043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up