Overview

  • Product name

  • Description

    Rabbit polyclonal to SOS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SOS1 aa 1140-1281.
    Sequence:

    LTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTS KAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLG KKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQE


    Database link: Q07889

  • Positive control

    • IHC-P: Human colon cancer and placenta tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Promotes the exchange of Ras-bound GDP by GTP.
  • Tissue specificity

    Expressed in gingival tissues.
  • Involvement in disease

    Defects in SOS1 are the cause of gingival fibromatosis 1 (GGF1) [MIM:135300]; also known as GINGF1. Gingival fibromatosis is a rare overgrowth condition characterized by a benign, slowly progressive, nonhemorrhagic, fibrous enlargement of maxillary and mandibular keratinized gingiva. GGF1 is usually transmitted as an autosomal dominant trait, although sporadic cases are common.
    Defects in SOS1 are the cause of Noonan syndrome type 4 (NS4) [MIM:610733]. NS4 is an autosomal dominant disorder characterized by dysmorphic facial features, short stature, hypertelorism, cardiac anomalies, deafness, motor delay, and a bleeding diathesis. It is a genetically heterogeneous and relatively common syndrome, with an estimated incidence of 1 in 1000-2500 live births. Rarely, NS4 is associated with juvenile myelomonocytic leukemia (JMML). SOS1 mutations engender a high prevalence of pulmonary valve disease; atrial septal defects are less common.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 PH domain.
    Contains 1 Ras-GEF domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • alternate SOS1 antibody
    • GF1 antibody
    • GGF1 antibody
    • GINGF antibody
    • gingival fibromatosis antibody
    • gingival fibromatosis hereditary 1 antibody
    • Guanine nucleotide exchange factor antibody
    • HGF antibody
    • NS4 antibody
    • Son of sevenless homolog 1 (Drosophila) antibody
    • Son of sevenless homolog 1 antibody
    • SOS Ras/Rac guanine nucleotide exchange factor 1 antibody
    • SOS-1 antibody
    • Sos1 antibody
    • SOS1_HUMAN antibody
    see all

Images

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SOS1 (green) using ab235894 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for SOS1 using ab235894 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human placenta tissue stained for SOS1 using ab235894 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up