Overview

  • Product name

  • Description

    Rabbit polyclonal to SOX10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to SOX10.
    Sequence:

    PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Properties

Applications

Our Abpromise guarantee covers the use of ab108408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia.
  • Tissue specificity

    Expressed in fetal brain and in adult brain, heart, small intestine and colon.
  • Involvement in disease

    Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E) [MIM:611584]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
    Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C) [MIM:613266]; also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
    Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome (YDBHS) [MIM:601706]. YDBHS consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome.
    Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH) [MIM:609136]; also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DOM antibody
    • DOM antibody
    • Dominant megacolon mouse human homolog of antibody
    • MGC15649 antibody
    • PCWH antibody
    • SOX 10 antibody
    • SOX10 antibody
    • SOX10_HUMAN antibody
    • SRY (sex determining region Y) box 10 antibody
    • SRY (sex determining region Y) box 10 antibody
    • SRY box 10 antibody
    • SRY box containing gene 10 antibody
    • SRY related HMG box gene 10 antibody
    • SRY related HMG box gene 10 antibody
    • Transcription factor SOX 10 antibody
    • Transcription factor SOX-10 antibody
    • WS2E antibody
    • WS4 antibody
    • WS4C antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human skin tissue, staining SOX10 with ab108408 at 4 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue, staining SOX10 with ab108408 at 4 µg/ml.

  • Anti-SOX10 antibody (ab108408) at 1/4000 dilution
    Secondary
    1/10000

    Predicted band size: 50 kDa



    Sample: HEK293 whole cell lysate

References

This product has been referenced in:

See all 3 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry free floating
Sample
Rat Tissue sections (Brain)
Specification
Brain

Abcam user community

Verified customer

Submitted Sep 05 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Whole trunk sections - embryonic neural tube and d)
Permeabilization
Yes - 0.1% Tween 20 in 1xPBS
Specification
Whole trunk sections - embryonic neural tube and d
Blocking step
Normal donkey serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Maria Eleni Kastriti

Verified customer

Submitted Jun 26 2017

Answer

Thank you for your enquiry,

We have the following general IHC-P procedure from the originator of this antibody. As stated on the online datasheet, the recommended starting dilution for the antibody is 4 - 8 µg/ml.

Please note that this may require some individual optimization.

I hope this will be helpful. If you have any further questions, please do not hesitate to contact me.



General IHC with Epitope Retrieval Protocol

Description:
Formalin or other aldehyde fixation forms protein cross-links that mask the antigenic sites in tissue specimens, leading to weak or false negative staining for immunohistochemical detection of certain proteins. Sodium citrate treatments breaks the protein cross-links, unmasking the antigens and epitopes in formalin-fixed and paraffin embedded tissue sections, enhancing staining intensity of antibodies

Procedure:
1. Deparaffinize sections in 3 changes of xylene, 5 minutes each

2. Hydrate in 2 changes of 100% ethanol for 3 minutes each, 95% and 80% ethanol for 1 minute each.

3. Rinse the sections in distilled water followed by 0.1 M PBS.

4. Quench endogenous peroxidase for 10 min with 3% H2O2 in 0.1 M PBS and wash 3 times with distilled water, 2 minutes each.

5. Retrieve epitopes by incubating the sections at 98-100° C in a microwave in 0.01 M citrate buffer (pH 6.0) for 10 minutes. Cool down in room temperature for 30-60 min.

6. Rinse the sections in 0.1 M PBS for 3 × 2 min.

7. Block the sections with 10% normal goat serum in 0.1 M PBS at room temperature for 30 min.

8. Incubate the sections with primary antibody at appropriate dilution in 0.1 M PBS (2-4µg /ml) overnight at 4 ° C.

9. Rinse the sections in 0.1 M PBS for 3 × 5 min.

10. Incubate the sections with biotinylated goat anti-rabbit IgG (1/200 in 0.1M PBS, 37° C, 20 min)

11. Rinse the sections in 0.1 M PBS for 3 × 5 min.

12. Incubate the sections with HRP-conjugated streptavidin (1/200 in 0.1 M PBS, 37° C, 20 min)

13. Rinse the sections with 0.1 M PBS for 3 × 5 min followed by 50 mM Tris-HCl buffer (pH 7.6).

14. Incubate with a peroxidase substrate solution.

15. Rinse the sections in distilled water.

16. Counterstain for 10-30 seconds with a hematoxylin counterstaining solution.

17. Rinse the sections with tap water.

18. Dehydrate through 70-80-90-95-100-100% of ethanols, each 3 minutes.

19. Clear in xylene for 2×3 min.

20. Coverslip with mounting medium.




Solutions and Reagents:
1: 0.01 M Citrate Buffer (pH 6.0)
Tris-sodium citrate ---------------------- 2.94 g
Distilled water -------------------------- 1000 ml
Mix to dissolve. Adjust pH to 6.0 with 1N HCl.
Note: this buffer is commonly used and works perfectly with many antibodies. It gives very
nice intense staining with very low background.

2: 0.1 M PBS

Na2PO44 - 2H2O 27.2g 54.5g
NaH2PO44 - 2H2O 2.8g 5.6g
NaCl 9g 18g
Distilled water 1000ml 2000ml
pH 7.4 7.4


3: 50 mM Tris-HCl Buffer
Tris 6g 12g
5N HCl 5-7ml 10-14ml
pH 7.6 7.6
Distilled water 1000ml 2000ml


4: Peroxydase Substrate Solution
50 mM Tris-HCl (pH 7.6) 49 ml
1% DAB 1 ml
30%H2O2 7 µl


5: Hematoxylin Counterstaining Solution
Hematoxylin 1g
Distilled water 1000ml
NaIO3 0.2g
KAl(SO4)2 - 12H2O 50g
Citric acid 1g
Trichloroacetaldehyde 50g

After hematoxylin is completely dissolved in distilled water, add NaIO3 and KAl (SO4)2.12H2O, stir until thoroughly dissolved. Then add citric acid and trichloroacetaldehyde stir until thoroughly dissolved.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up