For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    sox10-antibody-sox101074-bsa-and-azide-free-ab212845.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neural Stem Cell marker
Share by email

Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Protein Array - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
  • Western blot - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)

Key features and details

  • Mouse monoclonal [SOX10/1074] to SOX10 - BSA and Azide free
  • Suitable for: IHC-P, WB, Protein Array
  • Reacts with: Mouse, Human, Recombinant fragment
  • Isotype: IgG2b

You may also be interested in

Protein
Product image
Recombinant Human SOX10 protein (ab114238)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free
    See all SOX10 primary antibodies
  • Description

    Mouse monoclonal [SOX10/1074] to SOX10 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, Protein Arraymore details
  • Species reactivity

    Reacts with: Mouse, Human, Recombinant fragment
  • Immunogen

    Recombinant fragment aa 115-269. The exact sequence is proprietary.
    Sequence:

    AQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQH KKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDH RHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMG EGGKP


    Database link: P56693
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human melanoma and mouse brain tissues; A375 cell lysate; SOX10 recombinant protein.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Carrier free

    Yes
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    SOX10/1074
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neural Stem Cell marker
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • HMG Box
    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Developmental Biology
    • Lineage specification
    • Ectoderm

Associated products

  • Alternative Versions

    • Anti-SOX10 antibody [SOX10/1074] (ab216020)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • FITC Conjugation Kit (Fast) - Lightning-Link® (ab188285)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)
  • Recombinant Protein

    • Recombinant Human SOX10 protein (ab114238)

Applications

Our Abpromise guarantee covers the use of ab212845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 49 kDa.
Protein Array Use at an assay dependent concentration.

Target

  • Function

    Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia.
  • Tissue specificity

    Expressed in fetal brain and in adult brain, heart, small intestine and colon.
  • Involvement in disease

    Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E) [MIM:611584]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
    Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C) [MIM:613266]; also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
    Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome (YDBHS) [MIM:601706]. YDBHS consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome.
    Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH) [MIM:609136]; also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Target information above from: UniProt accession P56693 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 6663 Human
    • Entrez Gene: 20665 Mouse
    • Omim: 602229 Human
    • SwissProt: P56693 Human
    • SwissProt: Q04888 Mouse
    • Unigene: 376984 Human
    • Unigene: 276739 Mouse
    • Alternative names

      • DOM antibody
      • DOM antibody
      • Dominant megacolon mouse human homolog of antibody
      • MGC15649 antibody
      • PCWH antibody
      • SOX 10 antibody
      • SOX10 antibody
      • SOX10_HUMAN antibody
      • SRY (sex determining region Y) box 10 antibody
      • SRY (sex determining region Y) box 10 antibody
      • SRY box 10 antibody
      • SRY box containing gene 10 antibody
      • SRY related HMG box gene 10 antibody
      • SRY related HMG box gene 10 antibody
      • Transcription factor SOX 10 antibody
      • Transcription factor SOX-10 antibody
      • WS2E antibody
      • WS4 antibody
      • WS4C antibody
      see all

    Images

    • Protein Array - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      Protein Array - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      This data was produced with ab216020, the same antibody in a different formulation with BSA and Azide.
      ab216020 was tested in protein array against over 19000 different full-length human proteins.
      Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
      A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
    • Western blot - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      Western blot - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      All lanes : Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845) at 1 µg/ml

      Lane 1 : SOX10 recombinant protein
      Lane 2 : A375 cell lysate

      Predicted band size: 49 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)

      Immunohistochemical analysis of formalin-fixed and paraffin-embedded mouse brain tissue labeling SOX10 with ab212845 at 1 μg/ml dilution.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)

      Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human melanoma tissue labeling SOX10 with ab212845 at 1 μg/ml dilution.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab212845? Please let us know so that we can cite the reference in this datasheet.

    ab212845 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab212845.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.