Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
Key features and details
- Mouse monoclonal [SOX10/1074] to SOX10 - BSA and Azide free
- Suitable for: IHC-P, WB, Protein Array
- Reacts with: Mouse, Human, Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free
See all SOX10 primary antibodies -
Description
Mouse monoclonal [SOX10/1074] to SOX10 - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, Protein Arraymore details -
Species reactivity
Reacts with: Mouse, Human, Recombinant fragment -
Immunogen
Recombinant fragment aa 115-269. The exact sequence is proprietary.
Sequence:AQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQH KKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDH RHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMG EGGKP
Database link: P56693 -
Positive control
- Human melanoma and mouse brain tissues; A375 cell lysate; SOX10 recombinant protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 100% PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein A/G purified -
Clonality
Monoclonal -
Clone number
SOX10/1074 -
Isotype
IgG2b -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab212845 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 49 kDa. | |
Protein Array | Use at an assay dependent concentration. |
Target
-
Function
Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia. -
Tissue specificity
Expressed in fetal brain and in adult brain, heart, small intestine and colon. -
Involvement in disease
Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E) [MIM:611584]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C) [MIM:613266]; also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome (YDBHS) [MIM:601706]. YDBHS consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome.
Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH) [MIM:609136]; also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease. -
Sequence similarities
Contains 1 HMG box DNA-binding domain. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6663 Human
- Entrez Gene: 20665 Mouse
- Omim: 602229 Human
- SwissProt: P56693 Human
- SwissProt: Q04888 Mouse
- Unigene: 376984 Human
- Unigene: 276739 Mouse
-
Alternative names
- DOM antibody
- DOM antibody
- Dominant megacolon mouse human homolog of antibody
see all
Images
-
This data was produced with ab216020, the same antibody in a different formulation with BSA and Azide.
ab216020 was tested in protein array against over 19000 different full-length human proteins.
Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29. -
All lanes : Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845) at 1 µg/ml
Lane 1 : SOX10 recombinant protein
Lane 2 : A375 cell lysate
Predicted band size: 49 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
Immunohistochemical analysis of formalin-fixed and paraffin-embedded mouse brain tissue labeling SOX10 with ab212845 at 1 μg/ml dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SOX10 antibody [SOX10/1074] - BSA and Azide free (ab212845)
Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human melanoma tissue labeling SOX10 with ab212845 at 1 μg/ml dilution.
Protocols
Datasheets and documents
References (0)
ab212845 has not yet been referenced specifically in any publications.