Overview

  • Product name

  • Description

    Rabbit polyclonal to SOX11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human SOX11 aa 241-341.
    Sequence:

    QEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEG ASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVS T


    Database link: P35716

  • Positive control

    • WB: Rat and mouse brain tissue lysates. IHC-P: Human liver cancer and breast cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 47 kDa.

Target

Images

  • Paraffin-embedded human breast cancer tissue stained for SOX11 using ab234996 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for SOX11 using ab234996 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-SOX11 antibody (ab234996) at 1/500 dilution

    Lane 1 : Rat brain tissue lysate
    Lane 2 : Mouse brain tissue lysate

    Secondary
    All lanes : Polyclonal Goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa

References

ab234996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up