Overview

  • Product name

    Anti-SOX15 antibody - C-terminal
    See all SOX15 primary antibodies
  • Description

    Rabbit polyclonal to SOX15 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SOX15 aa 179-233 (C terminal).
    Sequence:

    SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPM PLTHL


    Database link: O60248

  • Positive control

    • ICC/IF: HaCaT (human keratinocyte cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Binds to the 5'-AACAAT-3' sequence.
  • Tissue specificity

    Widely expressed in fetal and adult tissues examined, highest level found in fetal spinal cord and adult brain and testis.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein SOX-12 antibody
    • Protein SOX-15 antibody
    • Protein SOX-20 antibody
    • SOX 12 protein antibody
    • SOX 15 antibody
    • SOX 15 protein antibody
    • SOX 20 protein antibody
    • SOX12 antibody
    • SOX12 protein antibody
    • SOX15 antibody
    • SOX15 protein antibody
    • SOX15_HUMAN antibody
    • SOX20 antibody
    • SOX20 protein antibody
    • SOX26 antibody
    • SOX27 antibody
    • SRY box 15 antibody
    • SRY sex determining region Y box 15 antibody
    • SRY sex determining region Y box 20 antibody
    • SRYbox 15 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (human keratocyte cell line) cells stained for SOX15 (green) using ab222024 at 4 µg/ml in ICC/IF.

References

ab222024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up