Overview

  • Product name

    Anti-SOX4 antibody [SOX4/2540]
    See all SOX4 primary antibodies
  • Description

    Mouse monoclonal [SOX4/2540] to SOX4
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SOX4 aa 1-474.
    Sequence:

    MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPS WCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLL KDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSK PGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCG SKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAAALLPL GAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLFG GLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPA AGRSPADHRGYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDE FEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFEPGSGSHFEFPDYC TPEVSEMISGDWLESSISNLVFTY


    Database link: Q06945

  • Positive control

    • IHC-P: Human colon carcinoma and breast carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at RT.

Target

  • Function

    Transcriptional activator that binds with high affinity to the T-cell enhancer motif 5'-AACAAAG-3' motif.
  • Tissue specificity

    Testis, brain, and heart.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ecotropic viral integration site 16 antibody
    • EVI 16 antibody
    • EVI16 antibody
    • Sox4 antibody
    • SOX4_HUMAN antibody
    • SRY (sex determining region Y) box 4 antibody
    • SRY box containing gene 4 antibody
    • SRY related HMG box gene 4 antibody
    • Transcription factor SOX-4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human breast carcinoma tissue stained for SOX4 using ab236557 at 2 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for SOX4 using ab236557 at 2 µg/ml in immunohistochemical analysis.

References

ab236557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up