Overview

  • Product name
  • Description
    Rabbit polyclonal to SOX7
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SOX7 aa 249-386.
    Sequence:

    SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQA HLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGA MALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS


    Database link: Q9BT81

  • Positive control
    • Human colon tissue; PC-3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab220293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 42 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded human colon tissue labeling SOX7 with ab220293 at 1/50 dilution.

  • Anti-SOX7 antibody (ab220293) at 1/100 dilution + PC-3 cell lysate

    Predicted band size: 42 kDa

References

This product has been referenced in:
  • Chen D  et al. miR-184 promotes cell proliferation in tongue squamous cell carcinoma by targeting SOX7. Oncol Lett 16:2221-2228 (2018). Read more (PubMed: 30008922) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up