Overview

  • Product name

  • Description

    Rabbit polyclonal to SOX8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SOX8 aa 173-222.
    Sequence:

    PRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTH


    Database link: P57073

  • Positive control

    • Human cerebral cortex tissue; RH30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in central nervous system, limb and facial development. May be involved in male sex determination. Binds the consensus motif 5'-[AT][AT]CAA[AT]G-3'.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC24837 antibody
    • SOX 8 antibody
    • Sox8 antibody
    • SOX8_HUMAN antibody
    • SRY (sex determining region Y) box 8 antibody
    • SRY box 8 antibody
    • SRY box containing gene 8 antibody
    • Transcription factor SOX 8 antibody
    • Transcription factor SOX-8 antibody
    • Transcription factor SOX8 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized RH30 cells labeling SOX8 with ab221053 at 4 μg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling SOX8 with ab221053 at 1/50 dilution.

References

ab221053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up