Overview

  • Product name

    Anti-SOX9 antibody [PCRP-SOX9-1A2]
    See all SOX9 primary antibodies
  • Description

    Mouse monoclonal [PCRP-SOX9-1A2] to SOX9
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, Protein Arraymore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan, Titi
  • Immunogen

    Recombinant full length protein corresponding to Human SOX9 aa 1-509.
    Sequence:

    MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQE NTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSK NKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESE KRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISP NAIFKALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKA DLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPP NGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTE QLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSS YYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQ PVYTQLTRP


    Database link: P48436

  • Positive control

    • IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2 - 4 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Incubate with primary ab for 30 minutes at RT

Protein Array Use at an assay dependent concentration.

Target

  • Function

    Plays an important role in the normal skeletal development. May regulate the expression of other genes involved in chondrogenesis by acting as a transcription factor for these genes.
  • Involvement in disease

    Defects in SOX9 are the cause of campomelic dysplasia (CMD1) [MIM:114290]. CMD1 is a rare, often lethal, dominantly inherited, congenital osteochondrodysplasia, associated with male-to-female autosomal sex reversal in two-thirds of the affected karyotypic males. A disease of the newborn characterized by congenital bowing and angulation of long bones, unusually small scapulae, deformed pelvis and spine and a missing pair of ribs. Craniofacial defects such as cleft palate, micrognatia, flat face and hypertelorism are common. Various defects of the ear are often evident, affecting the cochlea, malleus incus, stapes and tympanum. Most patients die soon after birth due to respiratory distress which has been attributed to hypoplasia of the tracheobronchial cartilage and small thoracic cage.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • campomelic dysplasia autosomal sex reversal antibody
    • CMD 1 antibody
    • CMD1 antibody
    • CMPD 1 antibody
    • CMPD1 antibody
    • SOX 9 antibody
    • Sox9 antibody
    • SOX9_HUMAN antibody
    • SRA 1 antibody
    • SRA1 antibody
    • SRXX2 antibody
    • SRXY10 antibody
    • SRY (sex determining region Y) box 9 (campomelic dysplasia autosomal antibody
    • SRY (sex determining region Y) box 9 antibody
    • SRY (sex determining region Y)-box 9 antibody
    • SRY (sex-determining region Y)-box 9 protein antibody
    • SRY related HMG box gene 9 antibody
    • Transcription factor SOX 9 antibody
    • Transcription factor SOX-9 antibody
    • transcription factor SOX9 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for SOX9 using ab238053 at 4 μg/mL in immunohistochemical analysis.

  • Analysis of Protein Array containing more than 19,000 full-length human proteins using ab238053.

    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD’s) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD’s) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.

References

ab238053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up