Anti-SP17 antibody (ab232826)
Key features and details
- Rabbit polyclonal to SP17
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-SP17 antibody
See all SP17 primary antibodies -
Description
Rabbit polyclonal to SP17 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant full length protein (His-T7-tag) corresponding to Mouse SP17 aa 1-149. Expressed in E. coli. N-terminal tags.
Sequence:MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKR EKTSFDPAEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTP FEESTEEEREQEEAAALKIQSLFRGHVAREEVKKMKSDKNENLKEEADN
Database link: Q62252 -
Positive control
- WB: Recombinant mouse SP17 protein; Mouse and rat testis tissue lysates. IHC-P: Mouse testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232826 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 17 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. -
Tissue specificity
Testis and sperm specific. -
Sequence similarities
Contains 1 IQ domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 20686 Mouse
- Entrez Gene: 85244 Rat
- SwissProt: Q62252 Mouse
- Unigene: 8637 Mouse
- Unigene: 29090 Rat
-
Alternative names
- Band 34 antibody
- Cancer/testis antigen 22 antibody
- CT22 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SP17 antibody (ab232826)
Formalin-fixed, paraffin-embedded mouse testis tissue stained for SP17 with ab232826 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
All lanes : Anti-SP17 antibody (ab232826) at 1 µg/ml
Lane 1 : Mouse testis tissue lysate
Lane 2 : Rat testis tissue lysate
Secondary
All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 17 kDa -
Anti-SP17 antibody (ab232826) at 2 µg/ml + Recombinant mouse SP17 protein
Predicted band size: 17 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232826 has not yet been referenced specifically in any publications.