Overview

  • Product name

    Anti-SP2 transcription factor antibody
    See all SP2 transcription factor primary antibodies
  • Description

    Rabbit polyclonal to SP2 transcription factor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SP2 transcription factor aa 66-189.
    Sequence:

    KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQ NPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQA IITPSPSSHKPVPIKPAPIQKSST


    Database link: Q02086

  • Positive control

    • IHC-P: Human tonsil tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SP2 transcription factor (green) using ab224326 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human tonsil tissue stained for SP2 transcription factor using ab224326 at 1/20 dilution in immunohistochemical analysis.

References

ab224326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up