Overview

  • Product name

    Anti-SPACA3 antibody - C-terminal
    See all SPACA3 primary antibodies
  • Description

    Rabbit polyclonal to SPACA3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse SPACA3 aa 169-217 (C terminal). The exact sequence is proprietary.
    Sequence:

    RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD


    Database link: Q9D9X8

  • Positive control

    • Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro.
  • Tissue specificity

    The processed form is expressed in sperm (at protein level). Expressed in testis, epididymis and placenta.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 22 family.
  • Post-translational
    modifications

    The processed form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Secreted and Cytoplasmic vesicle > secretory vesicle > acrosome membrane. Anterior acrosome in non-capacitated spermatozoa and retained in the equatorial segment and in the luminal face of both the inner and outer acrosomal membranes following capacitation and the acrosome reaction.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700025M08Rik antibody
    • ALLP17 antibody
    • Cancer/testis antigen 54 antibody
    • CT54 antibody
    • LYC3 antibody
    • Lysozyme like sperm specific secretory protein ALLP17 antibody
    • Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17 antibody
    • Lysozyme-like protein 3 antibody
    • LYZL3 antibody
    • processed form antibody
    • SACA3_HUMAN antibody
    • SLLP1 antibody
    • SPACA3 antibody
    • Sperm acrosome associated 3 antibody
    • Sperm acrosome membrane-associated protein 3 antibody
    • Sperm lysozyme-like protein 1 antibody
    • Sperm protein reactive with antisperm antibodies antibody
    • Sperm protein reactive with ASA antibody
    see all

Images

  • Anti-SPACA3 antibody - C-terminal (ab178725) at 1 µg/ml + Mouse spleen lysate at 10 µg

    Predicted band size: 25 kDa

References

ab178725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up