Overview

  • Product name

    Anti-SPAG8/SMP1 antibody
  • Description

    Rabbit polyclonal to SPAG8/SMP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPAG8/SMP1 aa 181-261.
    Sequence:

    PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTS WSQHCPWEPQKQPPWEFLQVLEPGARGLWKP


    Database link: Q99932

  • Positive control

    • IHC-P: Human testis tissue.
  • General notes

    Previously labelled as SPAG8. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in fertility and microtubule formation through interaction with RANBP9.
  • Tissue specificity

    Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > acrosome. Acrosomal region of the head of mature sperm cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • BS 84 antibody
    • CILD28 antibody
    • HSD 1 antibody
    • HSD-1 antibody
    • HSD1 antibody
    • hSMP1 antibody
    • MGC26201 antibody
    • MH SPAG8 antibody
    • OTTHUMP00000021352 antibody
    • OTTMUSP00000032209 antibody
    • SMP-1 antibody
    • SMP1 antibody
    • SPAG3 antibody
    • SPAG8 antibody
    • SPAG8_HUMAN antibody
    • Sperm associated antigen 8 antibody
    • Sperm associated antigen 8 like protein antibody
    • Sperm membrane protein 1 antibody
    • Sperm membrane protein BS-84 antibody
    • Sperm-associated antigen 8 antibody
    • Testicular tissue protein Li 177 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for SPAG8/SMP1 using ab224587 at 1/500 dilution in immunohistochemical analysis.

References

ab224587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up