Overview

  • Product name

  • Description

    Rabbit polyclonal to SPAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human SPAM1 aa 173-222 (internal sequence). The exact sequence is proprietary. NCBI Accession No. NP_694859.
    Sequence:

    QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP


    Database link: P38567

  • Positive control

    • 786-0 whole cell lysate.
  • General notes

     This product was previously labelled as Hyaluronidase PH20

     

Properties

Applications

Our Abpromise guarantee covers the use of ab193009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Function

    Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 56 family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • epididymis secretory sperm binding protein Li 96n antibody
    • HEL-S-96n antibody
    • HYA1 antibody
    • HYAL PH-20 antibody
    • HYAL PH20 antibody
    • Hyal-PH20 antibody
    • HYAL1 antibody
    • HYAL3 antibody
    • HYAL5 antibody
    • HYALP_HUMAN antibody
    • Hyaluronidase PH-20 antibody
    • Hyaluronoglucosaminidase PH-20 antibody
    • MGC26532 antibody
    • PH-20 Hyaluronidase antibody
    • PH20 antibody
    • PH20 Hyaluronidase antibody
    • SPAG15 antibody
    • SPAM-1 antibody
    • Spam1 antibody
    • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) antibody
    • Sperm adhesion molecule 1 antibody
    • Sperm surface protein PH-20 antibody
    • Sperm surface protein PH20 antibody
    • zona pellucida binding antibody
    see all

Images

  • Anti-SPAM1 antibody (ab193009) at 1 µg/ml + 786-0 whole cell lysate at 10 µg

    Predicted band size: 58 kDa

References

ab193009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up