Overview

  • Product name

  • Description

    Mouse polyclonal to Spartan
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Spartan aa 1-489.
    Sequence:

    MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFV QFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLR PRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANIT VYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAE HQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKDKPNRGEAQLV IPFSGKGYVLGETSNLPSPGKLITSHAINKTQDLLNQNHSANAVRLNSKI KVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSP RISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGS EDTFPNKRPRLEDKTVFDNFFIKKEQIKSSGNDPKYSTTTAQNSSSSSSQ SKMVNCPVCQNEVLESQINEHLDWCLEGDSIKVKSEESL


    Database link: AAH68478.1

  • Positive control

    • Lysate of 293T cell line transfected with Spartan.
  • General notes

    Previously labelled as C1orf124. 

Properties

Applications

Our Abpromise guarantee covers the use of ab167190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa.

Target

  • Sequence similarities

    Contains 1 UBZ-type zinc finger.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1orf124 antibody
    • CA124_HUMAN antibody
    • Chromosome 1 open reading frame 124 antibody
    • DDDL1880 antibody
    • dJ876B10.3 antibody
    • PRO4323 antibody
    • RP5-876B10.3 antibody
    • Spartan antibody
    • SprT-like domain at the N terminus antibody
    • SprT-like N-terminal domain antibody
    • Zinc finger RAD18 domain-containing protein C1orf124 antibody
    see all

Images

  • All lanes : Anti-Spartan antibody (ab167190) at 1 µg/ml

    Lane 1 : Lysate of 293T cells transfected with Spartan
    Lane 2 : Lysate of 293T cells (non-transfected)

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 55 kDa

References

ab167190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up