Overview

  • Product name

  • Description

    Rabbit polyclonal to Spastin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Spastin aa 550-616 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQ TLEAYIRWNKDFGDTTV


    Database link: Q9UBP0

  • Positive control

    • IHC-P: Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Spastin is thought have a role in microtubule dynamics through its function as a microtubule severing protein. It is localised to the centrosome of neuronal cells but is not found in glial cells. Mutation in the ATPase binding domain of spastin causes hereditary spastic paraplegias (HSP), a large group of clinically similar disorders. Mutant forms of spastin are generally found throughout the cytoplasm rather then within the nucleus.
  • Cellular localization

    Cytoplasm, Cytoskeleton, Endoplasmic reticulum, Endosome, Membrane, Microtubule, Nucleus
  • Database links

  • Alternative names

    • ADPSP antibody
    • FSP 2 antibody
    • FSP2 antibody
    • KIAA1083 antibody
    • Spast antibody
    • spastic paraplegia 4 (autosomal dominant; spastin) antibody
    • Spastic paraplegia 4 antibody
    • spastin antibody
    • SPG 4 antibody
    • SPG4 antibody
    • SPG4 gene antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded rat brain tissue labeling Spastin using ab214301 at 1/200, followed by secondary detection and DAB staining.

References

ab214301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up