Anti-Asef2 antibody (ab122627)
Key features and details
- Rabbit polyclonal to Asef2
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Asef2 antibody
See all Asef2 primary antibodies -
Description
Rabbit polyclonal to Asef2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Asef2 aa 172-281 (internal sequence).
Sequence:ALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNH ATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKST SNLADLRTAH
-
Positive control
- Human duodenum tissue; U 251 MG cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store undiluted. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122627 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
Notes |
---|
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Acts as guanine nucleotide exchange factor (GEF) for RHOA, RAC1 and CDC42 GTPases. Regulates cell migration and adhesion assembly and disassembly through a RAC1, PI3K, RHOA and AKT1-dependent mechanism. Increases both RAC1 and CDC42 activity, but decreases the amount of active RHOA. Required for MMP9 up-regulation via the JNK signaling pathway in colorectal tumor cells. Involved in tumor angiogenesis and may play a role in intestinal adenoma formation and tumor progression. -
Tissue specificity
Expressed at high levels in the placenta, spleen and kidney, at moderate levels in lung, small intestine, liver, brain and heart, and at low levels in skeletal muscle. Expression is aberrantly enhanced in most colorectal tumors. -
Sequence similarities
Contains 1 DH (DBL-homology) domain.
Contains 1 PH domain.
Contains 1 SH3 domain. -
Domain
The C-terminal tail is required for its GEF activity. -
Cellular localization
Cytoplasm. Cell projection > filopodium. Cell projection > lamellipodium. Cell projection > ruffle membrane. Accumulates in the lamellipodium and ruffle membrane in response to hepatocyte growth factor (HGF) treatment. - Information by UniProt
-
Database links
- Entrez Gene: 221178 Human
- Omim: 613324 Human
- SwissProt: Q96N96 Human
- Unigene: 595391 Human
-
Alternative names
- APC-stimulated guanine nucleotide exchange factor 2 antibody
- ARHGEF29 antibody
- Asef2 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab122627 has been referenced in 1 publication.
- Waseem NH et al. Mutations in SPATA13/ASEF2 cause primary angle closure glaucoma. PLoS Genet 16:e1008721 (2020). PubMed: 32339198