Overview

  • Product name

    Anti-SPATA2 antibody
  • Description

    Rabbit polyclonal to SPATA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SPATA2 aa 240-312.
    Sequence:

    KDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKD EIIRPSPSLLTMASSPHGSPDVL


    Database link: Q9UM82

  • Positive control

    • MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May have a role in the regulation of spermatogenesis.
  • Tissue specificity

    Highly expressed in Sertoli cells, but not detected in spermatogenic cells. Low expression in spleen, thymus and prostate.
  • Sequence similarities

    Belongs to the SPATA2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ13167 antibody
    • KIAA0757 antibody
    • PD 1 antibody
    • PD1 antibody
    • PPP1R145 antibody
    • Protein phosphatase 1 regulatory subunit 145 antibody
    • SPAT2_HUMAN antibody
    • SPATA 2 antibody
    • SPATA2 antibody
    • Spermatogenesis associated 2 antibody
    • Spermatogenesis associated PD1 antibody
    • Spermatogenesis associated protein 2 antibody
    • Spermatogenesis associated protein PD1 antibody
    • Spermatogenesis-associated protein 2 antibody
    • Spermatogenesis-associated protein PD1 antibody
    • Tamo antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling SPATA2 with ab220411 at 4 μg/ml (green).

References

ab220411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up