Anti-SPCS2/SPC25 antibody (ab121395)
Key features and details
- Rabbit polyclonal to SPCS2/SPC25
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-SPCS2/SPC25 antibody
See all SPCS2/SPC25 primary antibodies -
Description
Rabbit polyclonal to SPCS2/SPC25 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human SPCS2/SPC25 aa 2-65.
Sequence:AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKW DGSAVKNSLDDSAK
Database link: Q15005 -
Positive control
- WB: RT-4, U-251 MG, Human liver and tonsil; mouse NIH/3T3, rat NBT-II cells; IHC-P: Human epididymis, pancreas, colon, lymph node, cerebral cortex tissues; ICC/IF: human cell line U-2 OS
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121395 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 0.2 µg/ml.
|
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 0.2 µg/ml. |
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. -
Sequence similarities
Belongs to the SPCS2 family. -
Cellular localization
Microsome membrane. Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9789 Human
- Entrez Gene: 66624 Mouse
- Entrez Gene: 293142 Rat
- SwissProt: Q15005 Human
- SwissProt: Q9CYN2 Mouse
- Unigene: 282700 Human
-
Alternative names
- Microsomal signal peptidase 25 kDa subunit antibody
- Signal peptidase complex subunit 2 antibody
- Signal peptidase complex subunit 2 homolog (S. cerevisiae) antibody
see all
Images
-
All lanes : Anti-SPCS2/SPC25 antibody (ab121395) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryonic fibroblasts) cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumour) cell lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreas tissue labelling SPCS2/SPC25 with ab121395 at 1/50 dilution. Heat induced epitope retrieval pH 6 performed before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human colon tissue labelling SPCS2/SPC25 with ab121395 at 1/50 dilution. Heat induced epitope retrieval pH 6 performed before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling SPCS2/SPC25 with ab121395 at 1/50 dilution. Heat induced epitope retrieval pH 6 performed before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lymph node tissue labelling SPCS2/SPC25 with ab121395 at 1/50 dilution. Heat induced epitope retrieval pH 6 performed before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human epididymis tissue labelling SPCS2/SPC25 with ab121395 at 1/50 dilution. Heat induced epitope retrieval pH 6 performed before commencing with IHC staining protocol.
-
Immunocytochemistry/immunofluorescence analysis of human cell line U-2 OS labelling SPCS2/SPC25 with ab121395 at 2 µg/mL
-
All lanes : Anti-SPCS2/SPC25 antibody (ab121395) at 1/250 dilution
Lane 1 : RT-4
Lane 2 : U-251 MG
Lane 3 : Human plasma
Lane 4 : Human liver
Lane 5 : Human tonsil
Developed using the ECL technique.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab121395 has been referenced in 1 publication.
- Shi WK et al. SPC25 promotes hepatocellular carcinoma metastasis via activating the FAK/PI3K/AKT signaling pathway through ITGB4. Oncol Rep 47:N/A (2022). PubMed: 35293598