Overview

  • Product name

  • Description

    Rabbit polyclonal to SPCS2/SPC25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human SPCS2/SPC25 aa 2-65.
    Sequence:

    AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKW DGSAVKNSLDDSAK


    Database link: Q15005

  • Positive control

    • WB: RT-4, U-251 MG, Human liver and Human tonsil IHC-P: Human testis tissue
  • General notes

     This product was previously labelled as SPCS2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
  • Sequence similarities

    Belongs to the SPCS2 family.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Microsomal signal peptidase 25 kDa subunit antibody
    • Signal peptidase complex subunit 2 antibody
    • Signal peptidase complex subunit 2 homolog (S. cerevisiae) antibody
    • SPase 25 kDa subunit antibody
    • SPCS2 antibody
    • SPCS2_HUMAN antibody
    see all

Images

  • All lanes : Anti-SPCS2/SPC25 antibody (ab121395) at 1/250 dilution

    Lane 1 : RT-4

    Lane 2 : U-251 MG
    Lane 3 : Human plasma

    Lane 4 : Human liver

    Lane 5 : Human tonsil


    Developed using the ECL technique.
  • ab121395, at a 1/50 dilution, staining SPCS2/SPC25 in paraffin embedded Human testis tissue by Immunohistochemistry.

References

ab121395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up