Anti-SPCS2/SPC25 antibody (ab236972)
Key features and details
- Rabbit polyclonal to SPCS2/SPC25
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SPCS2/SPC25 antibody
See all SPCS2/SPC25 primary antibodies -
Description
Rabbit polyclonal to SPCS2/SPC25 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Dog, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human SPCS2/SPC25 aa 7-86.
Sequence:QGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAV KNSLDDSAKKVLLEKYKYVENFGLIDGRLT
Database link: Q15005 -
Positive control
- IHC-P: Human colon cancer and testis tissues. ICC/IF: HeLa cells. WB: K562 whole cell lysate.
-
General notes
This product was previously labelled as SPCS2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236972 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Predicted molecular weight: 25 kDa. | |
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. -
Sequence similarities
Belongs to the SPCS2 family. -
Cellular localization
Microsome membrane. Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 102116673 Cynomolgus monkey
- Entrez Gene: 404016 Dog
- Entrez Gene: 9789 Human
- Entrez Gene: 66624 Mouse
- Entrez Gene: 100172541 Orangutan
- SwissProt: Q4R512 Cynomolgus monkey
- SwissProt: Q28250 Dog
- SwissProt: Q15005 Human
see all -
Alternative names
- Microsomal signal peptidase 25 kDa subunit antibody
- Signal peptidase complex subunit 2 antibody
- Signal peptidase complex subunit 2 homolog (S. cerevisiae) antibody
see all
Images
-
Anti-SPCS2/SPC25 antibody (ab236972) at 1/500 dilution + K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 25 kDa -
HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for SPCS2/SPC25 (green) using ab236972 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPCS2/SPC25 antibody (ab236972)
Paraffin-embedded human testis tissue stained for SPCS2/SPC25 using ab236972 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPCS2/SPC25 antibody (ab236972)
Paraffin-embedded human colon cancer tissue stained for SPCS2/SPC25 using ab236972 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236972 has not yet been referenced specifically in any publications.