Overview

  • Product name

    Anti-SPCS3 antibody
  • Description

    Rabbit polyclonal to SPCS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human SPCS3 aa 33-180.
    Sequence:

    KDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDITADLENIFDWNV KQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDD GNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY


    Database link: P61009

  • Positive control

    • WB: Mouse kidney tissue lysate. IHC-P: Human placenta and liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 20 kDa.

Target

  • Relevance

    A component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
  • Cellular localization

    Endoplasmic reticulum and Microsome membrane;: Single-pass type II membrane protein
  • Database links

  • Alternative names

    • DKFZp564J1864 antibody
    • FLJ22649 antibody
    • Microsomal signal peptidase 22/23 kDa subunit antibody
    • Microsomal signal peptidase 23 kDa subunit antibody
    • PRO3567 antibody
    • Signal peptidase complex subunit 3 antibody
    • Signal peptidase complex subunit 3 homolog (S. cerevisiae) antibody
    • Signal peptidase complex subunit 3 homolog antibody
    • SPase 22 kDa subunit antibody
    • SPase 22/23 kDa subunit antibody
    • SPC22 antibody
    • SPC22/23 antibody
    • SPC3 antibody
    • UNQ1841 antibody
    • YLR066W antibody
    see all

Images

  • Anti-SPCS3 antibody (ab235598) at 1/500 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 20 kDa

  • Paraffin-embedded human placenta tissue stained for SPCS3 using ab235598 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for SPCS3 using ab235598 at 1/100 dilution in immunohistochemical analysis.

References

ab235598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up