Overview

  • Product name

    Anti-SPEM1 antibody
  • Description

    Rabbit polyclonal to SPEM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPEM1 aa 51-240. (BC033882: 51-240 aa)
    Sequence:

    SRFRGVLYQVFHDTICEKEAPKSSLLRKQTQPPKKQSSPAVHLRCTMDPV MMTVSPPPAHRHRRRGSPTRCAHCPVAWAPDTDDEKPHQYPAICSYHWDV PEDWEGFQHTQGTWVPWSQDAPESPPQTIRFQPTVEERPLKTGIWSELGL RAYVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQPVPA


    Database link: Q8N4L4

  • Positive control

    • HepG2 whole cell lysate

Properties

  • Form

    Lyophilised:Reconstitute in 200 ul of sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/200 - 1/1000. Predicted molecular weight: 35 kDa.

Target

Images

  • Anti-SPEM1 antibody (ab206109) at 1/500 dilution + HepG2 whole cell lysate

    Predicted band size: 35 kDa

References

ab206109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up