Overview

  • Product name

  • Description

    Rabbit polyclonal to SPF45
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SPF45 aa 42-112.
    Sequence:

    SQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGE VLIPLADEYDPMFPNDYEKVV


    Database link: Q96I25

  • Positive control

    • RT4 and U251 MG cell lysates; Human tonsil and liver tissue lysates; U2 OS cells; Human lateral ventricle tissue.
  • General notes

     This product was previously labelled as RBM17

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 45 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes the utilization of a cryptic splice site created by the beta-110 mutation in the HBB gene. The resulting frameshift leads to sickle cell anemia.
  • Sequence similarities

    Contains 1 G-patch domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 45 kDa-splicing factor antibody
    • RBM 17 antibody
    • Rbm17 antibody
    • RNA binding motif protein 17 antibody
    • RNA-binding motif protein 17 antibody
    • SPF 45 antibody
    • SPF45 antibody
    • SPF45_HUMAN antibody
    • Splicing factor (45 kD) antibody
    • Splicing factor (45kD) antibody
    • Splicing factor 45 antibody
    • Splicing factor 45 kDa antibody
    • Splicing factor 45kDa antibody
    see all

Images

  • All lanes : Anti-SPF45 antibody (ab204333) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate
    Lane 3 : Human plasma tissue lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 45 kDa

  • Immunofluorescent analysis of U2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling SPF45 with ab204333 at 4 μg/ml (green).

  • Immunohistochemical analysis of Paraffin-embedded Human lateral ventricle tissue labeling SPF45 with ab204333 at 1/200 dilution.

References

ab204333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up