Overview

  • Product name

  • Description

    Rabbit polyclonal to SPG11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPG11 aa 1351-1449.
    Sequence:

    RLHNMKLSISYLRECAKANDWLQFIIHSQLHNYHPAEVKSLIQYFSPVIQ DHLRLAFENLPSVPTSKMDSDQVCNKCPQELQGSKQEMTDLFEILLQCS


    Database link: Q96JI7

  • Positive control

    • IHC-P: Human rectum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in all structures of brain, with a high expression in cerebellum.
  • Involvement in disease

    Defects in SPG11 are the cause of spastic paraplegia autosomal recessive type 11 (SPG11) [MIM:604360]. Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Membrane. Cytoplasm > cytosol. Nucleus. Mainly cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • Colorectal carcinoma associated protein antibody
    • Colorectal carcinoma-associated protein antibody
    • DKFZp762B1512 antibody
    • FLJ21439 antibody
    • KIAA1840 antibody
    • Spastic paraplegia 11 (autosomal recessive) antibody
    • Spastic paraplegia 11 antibody
    • Spastic paraplegia 11 protein antibody
    • Spatacsin antibody
    • SPG 11 antibody
    • Spg11 antibody
    • SPTCS_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for SPG11 with ab243809 at a 1/50 dilution in immunohistochemical analysis.

References

ab243809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up