Anti-SPG11 antibody (ab243816)
Key features and details
- Rabbit polyclonal to SPG11
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SPG11 antibody
See all SPG11 primary antibodies -
Description
Rabbit polyclonal to SPG11 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment within Human SPG11 aa 655-764. The exact sequence is proprietary.
Sequence:IKFPWKLTDAIDEYDVHENVPKVKESNIWKKLSFEEVIASAILNNKIPEA QTFFRIDSHSAQKLEELIGIGLNLVFDNLKKNNIKEASELLKNMGFDVKG QLLKICFYTT
Database link: Q96JI7 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243816 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Expressed in all structures of brain, with a high expression in cerebellum. -
Involvement in disease
Defects in SPG11 are the cause of spastic paraplegia autosomal recessive type 11 (SPG11) [MIM:604360]. Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Membrane. Cytoplasm > cytosol. Nucleus. Mainly cytoplasmic. - Information by UniProt
-
Database links
- Entrez Gene: 80208 Human
- Omim: 610844 Human
- SwissProt: Q96JI7 Human
- Unigene: 656271 Human
- Unigene: 683876 Human
-
Alternative names
- Colorectal carcinoma associated protein antibody
- Colorectal carcinoma-associated protein antibody
- DKFZp762B1512 antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling SPG11 using ab243816 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPG11 antibody (ab243816)
Formalin-fixed, paraffin-embedded human kidney tissue stained for SPG11 with ab243816 at a 1/500 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab243816 has not yet been referenced specifically in any publications.