Overview

  • Product name

    Anti-SPG21/Maspardin antibody
    See all SPG21/Maspardin primary antibodies
  • Description

    Rabbit polyclonal to SPG21/Maspardin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SPG21/Maspardin aa 234-308.
    Sequence:

    AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAA IDPSMVSAEELEVQKGSLGISQEEQ


    Database link: Q9NZD8

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver and tonsil lysates; A549 cells.
  • General notes

     This product was previously labelled as SPG21

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Defects in SPG21 are the cause of Mast syndrome, an autosomal recessive hereditary spastic paraplegia with dementia and other CNS abnormalities (SPG21). Present at high frequency among the Old Order Amish. Subtle childhood abnormalities may be present, but the main features develop in early adulthood. The disease is slowly progressive, and cerebellar and extrapyramidal signs are also found in patients with advanced disease. Patients have a thin corpus callosum and white matter abnormalities. The protein encoded by this gene was identified by a two hybrid screen using CD4 as the bait. It binds to the hydrophobic C terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4.
  • Cellular localization

    Cytoplasm; cytosol. Membrane; peripheral membrane protein.
  • Database links

  • Alternative names

    • Acid cluster protein 33 antibody
    • ACP33 antibody
    • BM019 antibody
    • GL010 antibody
    • MAST antibody
    • Spastic paraplegia 21 autosomal recessive Mast syndrome protein antibody
    • SPG21 antibody antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A549 cells labeling SPG21/Maspardin with ab220229 at 4 μg/ml (green).

  • All lanes : Anti-SPG21/Maspardin antibody (ab220229) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 35 kDa

References

ab220229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up