Overview

  • Product name

    Anti-SPG3A/ATL1 antibody [1F6B12]
    See all SPG3A/ATL1 primary antibodies
  • Description

    Mouse monoclonal [1F6B12] to SPG3A/ATL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SPG3A/ATL1 aa 1-100. Expressed in E.coli.
    Sequence:

    MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDE TALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV


    Database link: Q8WXF7

  • Positive control

    • WB: Recombinant human SPG3A/ATL1 (aa 1-100) protein; SPG3A/ATL1 (aa 1-100)-hIgGFc transfected HEK-293 cell lysate.
  • General notes

     This product was previously labelled as SPG3A

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1F6B12
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.

Target

  • Function

    GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. May also regulate Golgi biogenesis. May regulate axonal development.
  • Tissue specificity

    Expressed predominantly in the adult and fetal central nervous system. Measurable expression in all tissues examined, although expression in adult brain is at least 50-fold higher than in other tissues. Detected predominantly in pyramidal neurons in the cerebral cortex and the hippocampus of the brain. Expressed in upper and lower motor neurons (at protein level).
  • Involvement in disease

    Defects in ATL1 are the cause of spastic paraplegia autosomal dominant type 3 (SPG3) [MIM:182600]; also known as Strumpell-Lorrain syndrome. Spastic paraplegia is a degenerative spinal cord disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs.
  • Sequence similarities

    Belongs to the GBP family. Atlastin subfamily.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell projection > axon.
  • Information by UniProt
  • Database links

  • Alternative names

    • AD FSP antibody
    • atl1 antibody
    • ATLA1_HUMAN antibody
    • Atlastin GTPase 1 antibody
    • Atlastin-1 antibody
    • Atlastin1 antibody
    • Brain specific GTP binding protein antibody
    • Brain-specific GTP-binding protein antibody
    • FSP1 antibody
    • GBP-3 antibody
    • GBP3 antibody
    • GTP-binding protein 3 antibody
    • Guanine nucleotide-binding protein 3 antibody
    • Guanylate binding protein 3 antibody
    • hGBP3 antibody
    • HSN1D antibody
    • Spastic paraplegia 3 protein A antibody
    • SPG 3A antibody
    • SPG3 antibody
    • SPG3A antibody
    • SPG3A gene antibody
    see all

Images

  • All lanes : Anti-SPG3A/ATL1 antibody [1F6B12] (ab233646) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : SPG3A/ATL1 (aa 1-100)-hlgGFc transfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
  • Anti-SPG3A/ATL1 antibody [1F6B12] (ab233646) at 1/500 dilution + Recombinant human SPG3A/ATL1 protein.


    Expected MW is 41kDa.

References

ab233646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up