Overview

  • Product name

    Anti-SPG48 antibody
  • Description

    Rabbit polyclonal to SPG48
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPG48 aa 234-348.
    Sequence:

    DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSA GRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLD VLCRQDPSFLYRSLS


    Database link: O43299

  • Positive control

    • WB: HL-60 cell lysate. IHC-P: Human stomach tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 49,67,89 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Relevance

    The function of SPG48 remains unknown. There are 3 named isoforms produced by alternative splicing.
  • Cellular localization

    Nucleolus
  • Database links

  • Alternative names

    • Hypothetical protein LOC9907 antibody
    • KIAA0415 antibody
    • Uncharacterized protein KIAA0415 antibody

Images

  • Paraffin-embedded human stomach tissue stained for SPG48 using ab224153 at 1/200 dilution in immunohistochemical analysis.

  • Anti-SPG48 antibody (ab224153) at 1/250 dilution + HL-60 (human promyelocytic leukemia cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 49,67,89 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SPG48 (green) using ab224153 at 4 µg/ml in ICC/IF.

References

ab224153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up