Overview

  • Product name

    Anti-Sphingomyelin Synthase 1 antibody
    See all Sphingomyelin Synthase 1 primary antibodies
  • Description

    Rabbit polyclonal to Sphingomyelin Synthase 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Sphingomyelin Synthase 1 aa 48-137.
    Sequence:

    PLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGS FSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFL


    Database link: Q86VZ5

  • Positive control

    • WB: HeLa and HepG2 whole cell lysate (ab7900). IHC-P: Human pancreatic tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 49 kDa.
IHC-P 1/200 - 1/500.

Target

  • Relevance

    Sphingomyelin synthase 1 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Sphingomyelin synthase 1 is required for cell growth and is also capable of suppressing BAX-mediated apoptosis and preventing cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. It may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.
  • Cellular localization

    Golgi Apparatus. Multi-pass membrane protein
  • Database links

  • Alternative names

    • MOB antibody
    • Phosphatidylcholine:ceramide cholinephosphotransferase 1 antibody
    • Protein Mob antibody
    • SGMS1 antibody
    • SMS 1 antibody
    • SMS1 antibody
    • TMEM23 antibody
    • Transmembrane protein 23 antibody
    see all

Images

  • All lanes : Anti-Sphingomyelin Synthase 1 antibody (ab235057) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa

  • Paraffin-embedded human pancreatic tissue stained for Sphingomyelin Synthase 1 using ab235057 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up