Anti-SPHK2 antibody (ab264042)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SPHK2 antibody
See all SPHK2 primary antibodies -
Description
Rabbit polyclonal to SPHK2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide corresponding to Human SPHK2 aa 120-155 conjugated to keyhole limpet haemocyanin.
Sequence:YPRGRRGARRRATRTFRADGAATYEENRAEAQRWAT
Database link: Q9NRA0 -
Positive control
- WB: Mouse stomach lysate. IHC-P: Mouse testis tissue. ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab264042 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/400. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/300 - 1/1000. Predicted molecular weight: 69 kDa. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra-and extracellular functions. Also acts on D-erythro-dihydrosphingosine, D-erythro-sphingosine and L-threo-dihydrosphingosine. Binds phosphoinositides. -
Sequence similarities
Contains 1 DAGKc domain. -
Cellular localization
Cytoplasm. Membrane and Lysosome membrane. - Information by UniProt
-
Database links
- Entrez Gene: 56848 Human
- Entrez Gene: 56632 Mouse
- Omim: 607092 Human
- SwissProt: Q9NRA0 Human
- SwissProt: Q9JIA7 Mouse
- Unigene: 528006 Human
- Unigene: 24222 Mouse
-
Alternative names
- SK 2 antibody
- Sphingosine kinase 2 antibody
- Sphingosine kinase type 2 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SPHK2 antibody (ab264042)4% Paraformaldehyde-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SPHK2 using ab264042 at 1/100 dilution for 90 minutes at 37°C (green). Secondary antibody is an FITC-conjugated Goat anti-rabbit IgG incubated for 90 minutes at 37°C.
The nuclear counterstain is DAPI (blue).
Blocked with normal goat serum for 20 minutes at 37°C.
-
Western blot - Anti-SPHK2 antibody (ab264042)Anti-SPHK2 antibody (ab264042) at 1/300 dilution + Mouse stomach lysate
Predicted band size: 69 kDaPrimary incubation overnight at 4°C.
Secondary incubation for 60 minutes at 37°C.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPHK2 antibody (ab264042)Paraformaldehyde-fixed, paraffin-embedded mouse testis tissue stained for SPHK2 using ab264042 at 1/400 overnight at 4°C, followed by an FITC-conjugated Goat anti-rabbit IgG for 90 minutes (green). The nuclear counterstain is DAPI (blue).
Antigen retrieval: Sodium citrate buffer (pH 6.0) for 15 minutes.
Blocking: Normal goat serum for 30 minutes at 37°C.
Datasheets and documents
References
ab264042 has not yet been referenced specifically in any publications.
