Anti-SPIF antibody (ab190261)
Key features and details
- Rabbit polyclonal to SPIF
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SPIF antibody -
Description
Rabbit polyclonal to SPIF -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SPIF aa 854-946.
Sequence:DKEHIQFLYERSMDALGKLLKTMMWDNVNAEDCQEMFNLLQMWLVSQKEW ERERAFQITAKVLTNDIEAPENFKIGSLLGLLAPHSCDTLPTI
Database link: Q7Z745 -
Positive control
- Human pancreas tissue.
-
General notes
This product was previously labelled as HEATR7B2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab190261 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Contains 15 HEAT repeats. - Information by UniProt
-
Database links
- Entrez Gene: 133558 Human
- SwissProt: Q7Z745 Human
- Unigene: 97714 Human
-
Alternative names
- 4930455B06Rik antibody
- DKFZp781F0822 antibody
- FLJ40243 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPIF antibody (ab190261)
Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling SPIF with ab190261 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPIF antibody (ab190261)
Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling SPIF with ab190261 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPIF antibody (ab190261)
Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling SPIF with ab190261 at 1/50 dilution.
Datasheets and documents
References (0)
ab190261 has not yet been referenced specifically in any publications.