Overview

  • Product name

  • Description

    Rabbit polyclonal to spindlin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human spindlin 1 aa 1-262.
    Sequence:

    MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPR RNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGL ELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDE WRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSP PAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDD FHIYVYDLVKTS


    Database link: Q9Y657

  • Positive control

    • MCF7, SW480, 293T, Jurkat, HeLa, HepG2, SHSY5Y and mouse brain extracts; A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab196938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 30 kDa.
IHC-P 1/50 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-spindlin 1 antibody (ab196938) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : SW480 cell extract
    Lane 3 : 293T cell extract
    Lane 4 : Jurkat cell extract
    Lane 5 : HeLa cell extract
    Lane 6 : HepG2 cell extract
    Lane 7 : SHSY5Y cell extract
    Lane 8 : Mouse brain extract

    Predicted band size: 30 kDa

  • Immunofluorescent analysis of A549 cells labeling spindlin 1 (green) with ab196938 at 1/50 dilution. Blue: DAPI for nuclear staining.

References

ab196938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up