Overview

  • Product name

  • Description

    Rabbit polyclonal to spindlin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human spindlin 1 aa 10-60 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQ H


    Database link: Q9Y657

  • Positive control

    • Mouse embryo tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling spindlin 1 with ab216498 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Song Q  et al. miR-409 Inhibits Human Non-Small-Cell Lung Cancer Progression by Directly Targeting SPIN1. Mol Ther Nucleic Acids 13:154-163 (2018). Read more (PubMed: 30290307) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up