Overview

  • Product name

    Anti-SPINK5/LEKTI antibody
    See all SPINK5/LEKTI primary antibodies
  • Description

    Rabbit polyclonal to SPINK5/LEKTI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to SPINK5/LEKTI aa 734-995. (Expressed in E.coli).
    Sequence:

    CAMCKERLEKEAAEKKKKEDEEKRNTETNKSDKEDKCHEYRSMQLDGRLI CTRENDPVRDADGKMHVNKCAMCQMMFEREANERKMREENSRSQPTNEAK DQCGEVHNSVEDAKPRPARSSLPSIRGISKDECSEFQNLMKNEKLTCPET DDPVRGADGTFYQNKCHMCRDVLKNEAMKRSGLQEKSSDIRSTKEGDPEF SSSSRDSDMCKNYRILPRMGYLCPKNLNPVCGDDGQTYSNPCMLCHENLM RQTNTRIHKQGA


    Database link: Q148R4

  • Positive control

    • WB: Recombinant mouse SPINK5/LEKTI protein. IHC-P: Mouse esophagus tissue.
  • General notes

     This product was previously labelled as SPINK5

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231136 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 115 kDa.

Target

  • Function

    Serine protease inhibitor, probably important for the anti-inflammatory and/or antimicrobial protection of mucous epithelia. Contribute to the integrity and protective barrier function of the skin by regulating the activity of defense-activating and desquamation-involved proteases. Inhibits KLK5, it's major target, in a pH-dependent manner. Inhibits KLK7, KLK14 CASP14, and trypsin.
  • Tissue specificity

    Highly expressed in the thymus and stratum corneum. Also found in the oral mucosa, parathyroid gland, Bartholin's glands, tonsils, and vaginal epithelium. Very low levels are detected in lung, kidney, and prostate.
  • Involvement in disease

    Defects in SPINK5 are the cause of Netherton syndrome (NETH) [MIM:256500]. NETH is an autosomal recessive congenital ichthyosis associated with hair shaft abnormalities and anomalies of the immune system. Typical features are ichthyosis linearis circumflexa, ichthyosiform erythroderma, trichorrhexis invaginata (bamboo hair), atopic dermatitis, and hayfever. High postnatal mortality is due to failure to thrive, infections and hypernatremic dehydration.
  • Sequence similarities

    Contains 15 Kazal-like domains.
  • Domain

    Contains at least one active inhibitory domain for trypsin (domain 6).
  • Post-translational
    modifications

    Proteolytically processed by furin in individual domains (D1, D5, D6, D8 through D11, and D9 through D15) exhibiting various inhibitory potentials for multiple proteases.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hemofiltrate peptide HF7665 antibody
    • ISK5_HUMAN antibody
    • LEKTI antibody
    • Lympho-epithelial Kazal-type-related inhibitor antibody
    • Lymphoepithelial Kazal type related inhibitor antibody
    • NETS antibody
    • NS antibody
    • Serine peptidase inhibitor Kazal type 5 antibody
    • SPINK5 antibody
    • VAKTI antibody
    see all

Images

  • Anti-SPINK5/LEKTI antibody (ab231136) at 2 µg/ml + Recombinant mouse SPINK5/LEKTI protein

    Predicted band size: 115 kDa

  • Paraffin-embedded mouse esophagus tissue stained for SPINK5/LEKTI with ab231136 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse esophagus tissue stained for SPINK5/LEKTI with ab231136 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up