Overview

  • Product name

    Anti-Spinophilin/Neurabin 2 antibody
    See all Spinophilin/Neurabin 2 primary antibodies
  • Description

    Rabbit polyclonal to Spinophilin/Neurabin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Spinophilin/Neurabin 2 aa 360-410 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    PERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALE E


    Database link: Q96SB3

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 89 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

  • Function

    Seems to act as a scaffold protein in multiple signaling pathways. Modulates excitatory synaptic transmission and dendritic spine morphology. Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May play an important role in linking the actin cytoskeleton to the plasma membrane at the synaptic junction. Believed to target protein phosphatase 1/PP1 to dendritic spines, which are rich in F-actin, and regulates its specificity toward ion channels and other substrates, such as AMPA-type and NMDA-type glutamate receptors. Plays a role in regulation of G-protein coupled receptor signaling, including dopamine D2 receptors and alpha-adrenergic receptors. May establish a signaling complex for dopaminergic neurotransmission through D2 receptors by linking receptors downstream signaling molecules and the actin cytoskeleton. Binds to ADRA1B and RGS2 and mediates regulation of ADRA1B signaling. May confer to Rac signaling specificity by binding to both, RacGEFs and Rac effector proteins. Probably regulates p70 S6 kinase activity by forming a complex with TIAM1 (By similarity). Required for hepatocyte growth factor (HGF)-induced cell migration.
  • Sequence similarities

    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications

    Stimulation of D1 (but not D2) dopamine receptors induces Ser-94 phosphorylation. Dephosphorylation of Ser-94 is mediated mainly by PP1 and to a lesser extent by PP2A. Phosphorylation of spinophilin disrupts its association with F-actin, but does not affect its binding to PP1.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. Cell projection > dendritic spine. Cell junction > synapse. Cell junction > adherens junction. Cytoplasm. Cell membrane. Cell projection > lamellipodium. Cell projection > filopodium. Cell projection > ruffle membrane. Enriched at synapse and cadherin-based cell-cell adhesion sites. In neurons, both cytosolic and membrane-associated, and highly enriched in the post-synaptic density apposed to exitatory synapses. Colocalizes with PPP1R2 at actin-rich adherens junctions in epithelial cells and in dendritic spines (By similarity). Accumulates in the lamellipodium, filopodium and ruffle membrane in response to hepatocyte growth factor (HGF) treatment.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ30345 antibody
    • NEB2_HUMAN antibody
    • Neurabin II antibody
    • Neurabin-2 antibody
    • Neurabin-II antibody
    • Neurabin2 antibody
    • NeurabinII antibody
    • Neural tissue specific F actin binding protein II antibody
    • p130 antibody
    • PP1bp134 antibody
    • PPP1R6 antibody
    • PPP1R9 antibody
    • Ppp1r9b antibody
    • Protein phosphatase 1 regulatory subunit 9B antibody
    • SPINO antibody
    • Spinophilin antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling Spinophilin/Neurabin 2 with ab203275 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Adelöf J  et al. PA28aß overexpression enhances learning and memory of female mice without inducing 20S proteasome activity. BMC Neurosci 19:70 (2018). Read more (PubMed: 30400847) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (SH-SY5Y neuronal cell line)
Permeabilization
No
Specification
SH-SY5Y neuronal cell line
Fixative
acetone/methanol 50/50

Dr. Julian Bursztyka

Verified customer

Submitted Nov 13 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up