Overview

  • Product name

    Anti-Spir-1 antibody
  • Description

    Rabbit polyclonal to Spir-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Spir-1 aa 374-474. This sequence can be found also in Isoforms 3 and 4, but not in Isoform 1.
    Sequence:

    LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKE NGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK


    Database link: Q08AE8-2

  • Positive control

    • RT4, U-251 MG, Human Plasma and Human Liver lysates, Human lateral ventricle tissue
  • General notes

    Store product undiluted. For continuous use, store at 2-8°C for one-two days. Working dilution samples should be discarded if not used within 12 hours. The antibody solution should be gently mixed before use.
    This antibody is mono-specific.

    Previously labelled as SPIRE1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab130403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 86 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport.
  • Sequence similarities

    Belongs to the spire family.
    Contains 1 KIND domain.
    Contains 2 WH2 domains.
  • Domain

    Binds to actin monomers via the WH2 domain.
    The Spir-box targets binding to intracellular membrane structures.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > perinuclear region. Punctate spots in perinuclear region and cytoplasm, co-localised with Rab11.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1135 antibody
    • MGC150621 antibody
    • MGC150622 antibody
    • Protein spire homolog 1 antibody
    • Spir 1 antibody
    • Spir-1 antibody
    • Spir1 antibody
    • SPIR1_HUMAN antibody
    • SPIRE 1 antibody
    • Spire homolog 1 antibody
    • spire1 antibody
    see all

Images

  • All lanes : Anti-Spir-1 antibody (ab130403) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human Plasma lysate
    Lane 4 : Human Liver lysate
    Lane 5 : Human Tonsil lysate

    Predicted band size: 86 kDa

  • Immunohistochemical analysis of paraffin embedded human lateral ventricle tissue labelled with ab130403 antibody at 1/500 dilution.

References

ab130403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab130403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up