Overview

  • Product name
  • Description
    Mouse polyclonal to sPLA2-IIE
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human sPLA2-IIE aa 1-142.
    Sequence:

    MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGG SHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTT CQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC

  • Positive control
    • sPLA2-IIE transfected 293T cell lysate.
  • General notes

    Previously labelled as Phospholipase A2 IIE. 

Properties

Applications

Our Abpromise guarantee covers the use of ab169045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function
    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids.
  • Tissue specificity
    Restricted to the brain, heart, lung, and placenta.
  • Sequence similarities
    Belongs to the phospholipase A2 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2IIE antibody
    • GIIE sPLA2 antibody
    • Group IIE secretory phospholipase A2 antibody
    • Group IIE secretory phospholipase A2 precursor antibody
    • PA2GE_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase GIIE antibody
    • Phosphatidylcholine 2-acylhydrolase 2E antibody
    • Phospholipase A2 group IIE antibody
    • Phospholipase A2 IIE antibody
    • Pla2g2e antibody
    • sPLA antibody
    • sPLA2-IIE antibody
    see all

Images

  • All lanes : Anti-sPLA2-IIE antibody (ab169045) at 1 µg/ml

    Lane 1 : sPLA2-IIE transfected 293T cell lysate
    Lane 2 : non transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-mouse HRP conjugated antibody at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 16 kDa

References

ab169045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up