Overview

  • Product name

  • Description

    Rabbit polyclonal to sPLA2-IIE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human sPLA2-IIE aa 19-49.
    Sequence:

    GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG


    Database link: Q9NZK7

  • Positive control

    • Human heart muscle tissue
  • General notes

    Previously labelled as Phospholipase A2 IIE. 

Properties

Applications

Our Abpromise guarantee covers the use of ab204576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids.
  • Tissue specificity

    Restricted to the brain, heart, lung, and placenta.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2IIE antibody
    • GIIE sPLA2 antibody
    • Group IIE secretory phospholipase A2 antibody
    • Group IIE secretory phospholipase A2 precursor antibody
    • PA2GE_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase GIIE antibody
    • Phosphatidylcholine 2-acylhydrolase 2E antibody
    • Phospholipase A2 group IIE antibody
    • Phospholipase A2 IIE antibody
    • Pla2g2e antibody
    • sPLA antibody
    • sPLA2-IIE antibody
    see all

Images

  • Immunohistochemical staining of Human heart muscle tissue labeling sPLA2-IIE using ab204576 at 1/20 diluiton.

References

ab204576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up