Overview

  • Product name

  • Description

    Rabbit polyclonal to sPLA2-X
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human sPLA2-X aa 43-165.
    Sequence:

    GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCY TRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQ TEYNLKYLFYPQFLCEPDSPKCD


    Database link: O15496

  • Positive control

    • IHC-P: Human melanoma cancer and liver cancer tissues.
  • General notes

     This product was previously labelled as Phospholipase A2 X

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.
  • Tissue specificity

    Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Group 10 secretory phospholipase A2 antibody
    • Group X secretory phospholipase A2 antibody
    • GX sPLA2 antibody
    • GXPLA2 antibody
    • GXSPLA2 antibody
    • PA2GX_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase GX antibody
    • Phosphatidylcholine 2-acylhydrolase 10 antibody
    • Phospholipase A2 group X antibody
    • PLA2G10 antibody
    • SPLA2 antibody
    • sPLA2-X antibody
    • sPLA2X antibody
    see all

Images

  • Paraffin-embedded human melanoma cancer tissue stained for sPLA2-X using ab223509 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for sPLA2-X using ab223509 at 1/100 dilution in immunohistochemical analysis.

References

ab223509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up