Overview

  • Product name

  • Description

    Rabbit polyclonal to SPLASH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPLASH aa 22-145.
    Sequence:

    ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCY DHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKR NLDTYQKRLRFYWRPHCRGQTPGC


    Database link: Q9UNK4

  • Positive control

    • IHC-P: Human kidney, pancreas and melanoma tissues.
  • General notes

     This product was previously labelled as Phospholipase A2 IID

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. L-alpha-1-palmitoyl-2-linoleoyl phosphatidylethanolamine is more efficiently hydrolyzed than the other phospholipids examined.
  • Tissue specificity

    Broadly expressed.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2IID antibody
    • EC 3.1.1.4 antibody
    • GIID sPLA2 antibody
    • Group IID secretory phospholipase A2 antibody
    • Group IID secretory phospholipase A2 precursor antibody
    • PA2GD_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase GIID antibody
    • Phosphatidylcholine 2-acylhydrolase 2D antibody
    • Phospholipase A2 group IID antibody
    • Pla2g2d antibody
    • PLA2IID antibody
    • Secretory phospholipase A2s antibody
    • Secretory type PLA stroma associated homolog antibody
    • Secretory-type PLA antibody
    • sPLA antibody
    • sPLA2-IID antibody
    • sPLA2S antibody
    • SPLASH antibody
    • stroma-associated homolog antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for SPLASH using ab238770 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for SPLASH using ab238770 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human melanoma tissue stained for SPLASH using ab238770 at 1/100 dilution in immunohistochemical analysis.

References

ab238770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up