Overview

  • Product name

    Anti-splicing factor 1 antibody
    See all splicing factor 1 primary antibodies
  • Description

    Rabbit polyclonal to splicing factor 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human splicing factor 1 aa 23-157.
    Sequence:

    NQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGI PPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPD FKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLI


    Database link: Q15637

  • Positive control

    • IHC-P: Human urinary bladder tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

Target

  • Relevance

    SF1 contains 1 KH domain, 1 CCHC type zinc finger, a nuclear transport domain and glutamine and proline rich regions. It is necessary for the ATP dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5' UACUAAC 3' of the pre mRNA. It may act as transcription repressor. There are 6 named isoforms produced by alternative splicing.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • BBP antibody
    • D11S636 antibody
    • Mammalian branch point binding protein mBBP antibody
    • OTTHUMP00000069749 antibody
    • OTTHUMP00000069750 antibody
    • OTTHUMP00000069752 antibody
    • Splicing factor 1 antibody
    • Transcription factor ZFM1 antibody
    • ZFM1 antibody
    • Zinc finger gene in MEN1 locus antibody
    • Zinc finger protein 162 antibody
    • ZNF162 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for splicing factor 1 (green) using ab224106 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human urinary bladder tissue stained for splicing factor 1 with ab224106 (1/50) in immunohistochemical analysis.

References

ab224106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up