Overview

  • Product name

  • Description

    Rabbit polyclonal to SPOCK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SPOCK1 aa 291-390.
    Sequence:

    FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEE GYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG


    Database link: Q08629

  • Positive control

    • IHC-P: Human prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    SPOCK1 is the protein core of a seminal plasma proteoglycan containing chondroitin- and heparan-sulfate chains. The protein's function is unknown, although similarity to thyropin-type cysteine protease-inhibitors suggests its function may be related to protease inhibition.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.
  • Database links

  • Alternative names

    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan 1 antibody
    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan antibody
    • SPOCK antibody
    • Testican 1 antibody
    • TESTICAN antibody
    • TIC1 antibody
    • TICN1 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for SPOCK1 using ab224071 at 1/50 dilution in immunohistochemical analysis.

References

ab224071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up